PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G052900.1.p
Common NameSb03g004590, SORBIDRAFT_03g004590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 269aa    MW: 27315.9 Da    PI: 7.7978
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G052900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.52.7e-44291281100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++
  Sobic.003G052900.1.p  29 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHR 117
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l++el+++++e
  Sobic.003G052900.1.p 118 LQKELDAAHAE 128
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3928129IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4329126IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MASPSSTSNN SALSPVAASG ATTPGAGAPC AACKFLRRKC LPGCVFAPYF PPEEPQKFAN  60
VHKVFGASNV TKLLNELLPH QREDAVSSLA YEAEARVKDP VYGCVGAISV LQRQVHRLQK  120
ELDAAHAELL RYACGDVAAG IPTALPVSVS VSAAPRLSTA MTTSPGQFAA AAATAHATAG  180
MYGSSRRLGV LDGVVAAPPP PPPAGGCYFM RNHSNVISSP PGADVAPVLP YASMANWAVN  240
AISASTTTTS GSESIGGLDH KEGGDSSM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3277030.0DQ327703.1 Sorghum bicolor ramosa 2 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455115.10.0hypothetical protein SORBIDRAFT_03g004590
TrEMBLC5XNG80.0C5XNG8_SORBI; Putative uncharacterized protein Sb03g004590
STRINGSb03g004590.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.48e-65LBD family protein